Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q2FIC4

Expression Region

1-142

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucokinase (GCK) (NM_033508) Human Over-expression Lysate
LC403250 20 µg

Glucokinase (GCK) (NM_033508) Human Over-expression Lysate

Sign In for Pricing
View Details
L1CAM Antibody
KC-1804-01 50 μL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1804-02 100 µL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1804-03 1 mL

L1CAM Antibody

Sign In for Pricing
View Details
FABP3 (N-term) Rabbit Polyclonal Antibody
AP17354PU-N 400 µL

FABP3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein A  Colloidal Gold, 1mL 15nm
GP-01-15 1 mL

Protein A Colloidal Gold, 1mL 15nm

Sign In for Pricing
View Details