Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q2FIC4

Expression Region

1-142

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paradisin C
TRC-P378530-25MG 25 mg

Paradisin C

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
REV1 Human Gene Knockout Kit (CRISPR)
KN417528 1 Kit

REV1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Orthopedics tractor rack BOPT-401
BOPT-401 1 Unit

Orthopedics tractor rack BOPT-401

Sign In for Pricing
View Details
DOK5 (NM_018431) Human Over-expression Lysate
LY402687 100 µg

DOK5 (NM_018431) Human Over-expression Lysate

Sign In for Pricing
View Details
PPAR alpha (PPARA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]
TA503543AM 100 µL

PPAR alpha (PPARA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

Sign In for Pricing
View Details