Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q2FIC4

Expression Region

1-142

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INO80E (NM_173618) Human Recombinant Protein
TP308292L 1 mg

INO80E (NM_173618) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse CD45R Recombinant Rat Monoclonal Antibody
HA601385 100 µL

Mouse CD45R Recombinant Rat Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Cnr2 activation kit by CRISPRa
GA200794 1 Kit

Mouse Cnr2 activation kit by CRISPRa

Sign In for Pricing
View Details
Carboxylated PCR Plates - semi skirted
PCR960204-COOH 10 Plates

Carboxylated PCR Plates - semi skirted

Sign In for Pricing
View Details
TTLL9 Human Gene Knockout Kit (CRISPR)
KN421841 1 Kit

TTLL9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BEGAIN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6E7]
TA810836BM 100 µL

BEGAIN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6E7]

Sign In for Pricing
View Details