Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q2FZV2

Expression Region

1-142

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XAB2 Rabbit Polyclonal Antibody (PerCP)
orb2403679 100 µL

XAB2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Fruit fly mei-218/218 Rabbit Polyclonal Antibody (Fluoro647)
orb3087766 200 µL

Fruit fly mei-218/218 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
SLITRK5 Antibody (FITC)
abx317209-01 20 µg

SLITRK5 Antibody (FITC)

Sign In for Pricing
View Details
SLITRK5 Antibody (FITC)
abx317209-02 50 µg

SLITRK5 Antibody (FITC)

Sign In for Pricing
View Details
SLITRK5 Antibody (FITC)
abx317209-03 100 µg

SLITRK5 Antibody (FITC)

Sign In for Pricing
View Details
SLITRK5 Antibody (FITC)
abx317209-04 200 µg

SLITRK5 Antibody (FITC)

Sign In for Pricing
View Details