Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q2FZV2

Expression Region

1-142

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK beta 1 Rabbit Monoclonal Antibody
orb2989135-01 30 µL

AMPK beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AMPK beta 1 Rabbit Monoclonal Antibody
orb2989135-02 50 µL

AMPK beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AMPK beta 1 Rabbit Monoclonal Antibody
orb2989135-03 100 µL

AMPK beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AMPK beta 1 Rabbit Monoclonal Antibody
orb2989135-04 200 µL

AMPK beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Itgb2 Mouse shRNA Plasmid (Locus ID 16414)
TR501120 1 Kit

Itgb2 Mouse shRNA Plasmid (Locus ID 16414)

Sign In for Pricing
View Details
ACY2, NT (Aminoacylase-2, ACY-2, Aspartoacylase, ASP, ASPA) (MaxLight 650) discontinued
A1374-08-ML650 100 µL

ACY2, NT (Aminoacylase-2, ACY-2, Aspartoacylase, ASP, ASPA) (MaxLight 650) discontinued

Sign In for Pricing
View Details