Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q2FZV2

Expression Region

1-142

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP-100 CRISPR Activation Plasmid (m2)
sc-423095-ACT-2 20 µg

SP-100 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
SCA21 Adenovirus (Human)
43067051 1.0 mL

SCA21 Adenovirus (Human)

Sign In for Pricing
View Details
Slc21a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7015606 1.0 µg DNA

Slc21a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (PMT9312_0775)
MBS1372639-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (PMT9312_0775)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (PMT9312_0775)
MBS1372639-02 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (PMT9312_0775)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (PMT9312_0775)
MBS1372639-03 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (PMT9312_0775)

Sign In for Pricing
View Details