Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q4L4W6

Expression Region

1-142

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQNNNLMFQYAAVIIAFLIALFGVTLFFAGHYTPGGGFVGGLLLSCALTIIAIAFDIK TMEKVFPWDFKILIGIGLLFCVATPLASWFYGENFFTHTEFNIPLPLLQPVHMNTPMFFD FGVLCAVVGTIMTIIITIGESE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCXR Rabbit Polyclonal Antibody (BF555)
orb2516998 100 µL

DCXR Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Hsa-miR-4538 mimic
HY-R01166-01 5 nmol

Hsa-miR-4538 mimic

Sign In for Pricing
View Details
Hsa-miR-4538 mimic
HY-R01166-02 20 nmol

Hsa-miR-4538 mimic

Sign In for Pricing
View Details
Rabbit Polyclonal NDUFB7 Antibody
NBP1-88938 0.1 mL

Rabbit Polyclonal NDUFB7 Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain B/BL21-DE3) NLPI Polyclonal Antibody
MBS7179390 Inquire

Rabbit anti-Escherichia coli (strain B/BL21-DE3) NLPI Polyclonal Antibody

Sign In for Pricing
View Details
Plpp1 (NM_008247) Mouse Untagged Clone
MC209210 10 µg

Plpp1 (NM_008247) Mouse Untagged Clone

Sign In for Pricing
View Details