Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q4L4W6

Expression Region

1-142

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQNNNLMFQYAAVIIAFLIALFGVTLFFAGHYTPGGGFVGGLLLSCALTIIAIAFDIK TMEKVFPWDFKILIGIGLLFCVATPLASWFYGENFFTHTEFNIPLPLLQPVHMNTPMFFD FGVLCAVVGTIMTIIITIGESE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GR148672X
MBS5754918 Inquire

GR148672X

Sign In for Pricing
View Details
KCNG4 Protein Vector (Human) (pPM-C-HA)
PV022131 500 ng

KCNG4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-Podisus maculiventris (Spined soldier bug) Thanatin Polyclonal Antibody
MBS7160094 Inquire

Rabbit anti-Podisus maculiventris (Spined soldier bug) Thanatin Polyclonal Antibody

Sign In for Pricing
View Details
NOS1 Antibody
CSB-PA003463-01 50 µg

NOS1 Antibody

Sign In for Pricing
View Details
NOS1 Antibody
CSB-PA003463-02 100 µg

NOS1 Antibody

Sign In for Pricing
View Details
Dog Primary Umbilical Cord-derived Mesenchymal Stem Cells
T5490 5x105 cells / 1 mL

Dog Primary Umbilical Cord-derived Mesenchymal Stem Cells

Sign In for Pricing
View Details