Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q5HHD4

Expression Region

1-142

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANX1 Peptide
MBS154010-01 0.05 mg

PANX1 Peptide

Sign In for Pricing
View Details
PANX1 Peptide
MBS154010-02 5x 0.05 mg

PANX1 Peptide

Sign In for Pricing
View Details
EFEMP2 Antibody (C-term)
orb1928014-01 50 µL

EFEMP2 Antibody (C-term)

Sign In for Pricing
View Details
EFEMP2 Antibody (C-term)
orb1928014-02 100 µL

EFEMP2 Antibody (C-term)

Sign In for Pricing
View Details
Bovine 26S Protease Regulatory Subunit 6A (PSMC3) ELISA Kit
OM621429 96 Strip Well

Bovine 26S Protease Regulatory Subunit 6A (PSMC3) ELISA Kit

Sign In for Pricing
View Details
ADAM9 rabbit pAb Antibody
orb772232-01 50 μL

ADAM9 rabbit pAb Antibody

Sign In for Pricing
View Details