Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q5HHD4

Expression Region

1-142

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WTAP / Pre-mRNA-splicing regulator WTAP Recombinant Protein
R1509h 1 Each

Human WTAP / Pre-mRNA-splicing regulator WTAP Recombinant Protein

Sign In for Pricing
View Details
Reagent soda ash Rim,RB
1211895 1000 PCK

Reagent soda ash Rim,RB

Sign In for Pricing
View Details
Lentiviral mouse 2210010C04Rik shRNA (UAS) - Lentiviral mouse 2210010C04Rik shRNA (UAS, iRFP) (25)
GTR15202634 1 Vial

Lentiviral mouse 2210010C04Rik shRNA (UAS) - Lentiviral mouse 2210010C04Rik shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Znrf1 ORF Vector (Mouse) (pORF)
ORF062751 1.0 µg DNA

Znrf1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ReadyStrain™ Cell Straining Kits
C5040 50 Units/Pack

ReadyStrain™ Cell Straining Kits

Sign In for Pricing
View Details
CSF2 / GM-CSF Polyclonal Antibody
ANT-11676-50ug 50 µg

CSF2 / GM-CSF Polyclonal Antibody

Sign In for Pricing
View Details