Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q5HHD4

Expression Region

1-142

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMPRSS11B protein
orb392575-01 10 µg

Human TMPRSS11B protein

Sign In for Pricing
View Details
Human TMPRSS11B protein
orb392575-02 50 µg

Human TMPRSS11B protein

Sign In for Pricing
View Details
Human TMPRSS11B protein
orb392575-03 500 µg

Human TMPRSS11B protein

Sign In for Pricing
View Details
DFNB74 sgRNA CRISPR Lentivector (Human) (Target 2)
K0593903 1.0 µg DNA

DFNB74 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SAPAP (pan) Antibody
abx443229 100 µg

SAPAP (pan) Antibody

Sign In for Pricing
View Details
PTGS1 Protein Vector (Rat) (pPM-C-HA)
38102026 500 ng

PTGS1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details