Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q6GID7

Expression Region

1-142

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A3 Antibody
GWB-MW450I 50 µg

MS4A3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Dicer Antibody [PE]
NBP2-88949PE 0.1 mL

Rabbit Polyclonal Dicer Antibody [PE]

Sign In for Pricing
View Details
Carboxypeptidase D antibody
70R-7513 50 ug

Carboxypeptidase D antibody

Sign In for Pricing
View Details
CD38 discontinued
309862 100 µL

CD38 discontinued

Sign In for Pricing
View Details
TUBB3 Antibody
orb736874-01 1 mL

TUBB3 Antibody

Sign In for Pricing
View Details
TUBB3 Antibody
orb736874-02 3 mL

TUBB3 Antibody

Sign In for Pricing
View Details