Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q6GAX5

Expression Region

1-142

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cervix
CS706785 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
H-L-Lys (Boc) -OtBu*HCl
sc-295099A 5 g

H-L-Lys (Boc) -OtBu*HCl

Sign In for Pricing
View Details
ZNF124 Rabbit Polyclonal Antibody
orb575575 100 µL

ZNF124 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS Spike RBD Recombinant Protein His-Avi Tag Lyophilized 100UG
ISARSSTRBDRHISAVILY100UG 100 µg

SARS Spike RBD Recombinant Protein His-Avi Tag Lyophilized 100UG

Sign In for Pricing
View Details
Meloside A
C04726-1mg 1 mg

Meloside A

Sign In for Pricing
View Details
Gzmd (NM_010372) Mouse Untagged Clone
MC208614 10 µg

Gzmd (NM_010372) Mouse Untagged Clone

Sign In for Pricing
View Details