Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q6GAX5

Expression Region

1-142

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PAC2 Antibody (OTI1E8) [PE]
NBP2-73215PE 0.1 mL

Mouse Monoclonal PAC2 Antibody (OTI1E8) [PE]

Sign In for Pricing
View Details
Rat Monoclonal IL-3 Antibody (MP2-8F8) [Alexa Fluor 532]
NBP1-51826AF532 0.5 mL

Rat Monoclonal IL-3 Antibody (MP2-8F8) [Alexa Fluor 532]

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-600 Vector
mh31064 500 ng

LentimiRa-Off-hsa-miR-600 Vector

Sign In for Pricing
View Details
Muscle (Skeletal (Receptor Tyrosine Kinase (MUSK) Human ELISA Kit
F1461 96 Tests

Muscle (Skeletal (Receptor Tyrosine Kinase (MUSK) Human ELISA Kit

Sign In for Pricing
View Details
Iguratimod Impurity 55
RM-I071879-01 10 mg

Iguratimod Impurity 55

Sign In for Pricing
View Details
Iguratimod Impurity 55
RM-I071879-02 25 mg

Iguratimod Impurity 55

Sign In for Pricing
View Details