Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium radiotolerans Protein CrcB homolog (crcB)

This Recombinant Methylobacterium radiotolerans Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B1M4Y4

Expression Region

1-143

Origin

Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTTCILVMIGGALGTLARYVVSVLSLPISRDLPWGTILINVTGSFIIGLFGTLTLAQG RFPVSENVRLFVMIGLCGGYTTFSSFSLQTLDLMRNGAVVRAMVNVCASVVLCVLAVALG HVVAAHWNGGAVQIAQVSIEEDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL
BNC682871-100 1x 100 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF488A conjugate, 0.1mg/mL
BNC881819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details