Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q6NG99

Expression Region

1-143

Origin

Corynebacterium diphtheriae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKATSKIMYSMATFLAIMAIIYLFATMHVEDSGYMVGYEWAGGVCMILGTLLTVMLGGYL HFTENRIDVLPEDWEEAEVADAAGTLGFFSPSSIWPLAMSGAIAVLGFGIVYMHYWLIAI GAVLLIYTTTMLNLQYGIPKEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 6 (IL6) High-sensitive ELISA Kit
EKU12501 96 Tests

Mouse Interleukin 6 (IL6) High-sensitive ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD46 Antibody (122.2) [DyLight 680]
NBP2-33159FR 0.1 mL

Mouse Monoclonal CD46 Antibody (122.2) [DyLight 680]

Sign In for Pricing
View Details
Myelin Basic Protein (1-20)
PMB-3972-PI-01 1 mg

Myelin Basic Protein (1-20)

Sign In for Pricing
View Details
Myelin Basic Protein (1-20)
PMB-3972-PI-02 5 mg

Myelin Basic Protein (1-20)

Sign In for Pricing
View Details
MSC Antibody
R35056-100UG 100 µg

MSC Antibody

Sign In for Pricing
View Details
Human Trace amine-associated receptor 1, TAAR1 ELISA KIT
E7411Hu-01 48 Well

Human Trace amine-associated receptor 1, TAAR1 ELISA KIT

Sign In for Pricing
View Details