Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q6NG99

Expression Region

1-143

Origin

Corynebacterium diphtheriae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKATSKIMYSMATFLAIMAIIYLFATMHVEDSGYMVGYEWAGGVCMILGTLLTVMLGGYL HFTENRIDVLPEDWEEAEVADAAGTLGFFSPSSIWPLAMSGAIAVLGFGIVYMHYWLIAI GAVLLIYTTTMLNLQYGIPKEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Granulin (GRN)
FY-AB47502-01 1 mL

Anti-Granulin (GRN)

Sign In for Pricing
View Details
Anti-Granulin (GRN)
FY-AB47502-02 100 µL

Anti-Granulin (GRN)

Sign In for Pricing
View Details
Anti-Granulin (GRN)
FY-AB47502-03 200 µL

Anti-Granulin (GRN)

Sign In for Pricing
View Details
Rabbit Monoclonal Uroplakin Ia Antibody (UPK1A/8704R) [DyLight 650]
NBP3-21073C 0.1 mL

Rabbit Monoclonal Uroplakin Ia Antibody (UPK1A/8704R) [DyLight 650]

Sign In for Pricing
View Details
Human BMP2
E55A12412 100 µg

Human BMP2

Sign In for Pricing
View Details
BLVRA CRISPRa sgRNA lentivector (set of three targets)(Rat)
13348126 3x 1.0µg DNA

BLVRA CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details