Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q8FNQ8

Expression Region

1-143

Origin

Corynebacterium efficiens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSSSKIMYGLTVFLAAMAVIYIFGTMYVDDRGSVMGLEWVGATALVLSTALTLMLGVYI HITERRTDVLPEDWEEAEVADKAGTLGFFSPGSIWPAAMSGAVGLLGFGIIFMHYWLILV GALALTYTIAKLNFQYGVPREKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKOR1 CRISPR Knock Out 293T Cell Line (Human)
43843141 1x 10^6 Cells / 1.0 mL

SKOR1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ADCY6 Antibody
orb414593-01 50 µg

ADCY6 Antibody

Sign In for Pricing
View Details
ADCY6 Antibody
orb414593-02 100 µg

ADCY6 Antibody

Sign In for Pricing
View Details
IL6 Antibody
K03005M02B05C-01 50 ug

IL6 Antibody

Sign In for Pricing
View Details
IL6 Antibody
K03005M02B05C-02 100 ug

IL6 Antibody

Sign In for Pricing
View Details
IL6 Antibody
K03005M02B05C-03 1 mg

IL6 Antibody

Sign In for Pricing
View Details