Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q8FNQ8

Expression Region

1-143

Origin

Corynebacterium efficiens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSSSKIMYGLTVFLAAMAVIYIFGTMYVDDRGSVMGLEWVGATALVLSTALTLMLGVYI HITERRTDVLPEDWEEAEVADKAGTLGFFSPGSIWPAAMSGAVGLLGFGIIFMHYWLILV GALALTYTIAKLNFQYGVPREKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YIPF6 Adenovirus (Human)
50616051 1.0 mL

YIPF6 Adenovirus (Human)

Sign In for Pricing
View Details
Thsd1 AAV siRNA Pooled Vector
46673164 1.0 µg

Thsd1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Nob1 sgRNA CRISPR Lentivector set (Rat)
K7342701 3x 1.0 µg

Nob1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
NKIRAS2 Protein Vector (Human) (pPM-C-His)
PV028388 500 ng

NKIRAS2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
BMS1 Protein Vector (Mouse) (pPB-C-His)
PV159618 500 ng

BMS1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
NLRP6 Antibody
A57729-100UL 100 µL

NLRP6 Antibody

Sign In for Pricing
View Details