Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q8NNK3

Expression Region

1-143

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSSAKLMYGPTVFMAAMAVIYIFATMHVSDGGSVKGVEWVGSVALVLSAGLTLMLGVYL HFTEVRVDVLPEDWEEAEVADKAGTLGFFSPSSIWPAAMSGAVGFLAFGVVYFHYWMIAV GLMLLIFTITKLNLQYGVPKEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131US-01 25 µg

Elab Fluor® Red 780 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131US-02 100 µg

Elab Fluor® Red 780 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
cis-Clomiphene Hydrochloride
TRC-C587030-5MG 5 mg

cis-Clomiphene Hydrochloride

Sign In for Pricing
View Details
CARMIL3 Human Gene Knockout Kit (CRISPR)
KN419048 1 Kit

CARMIL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(R)-N-Desacryloyl N-3-Chloropropionyl Ibrutinib
TRC-D288110-250MG 250 mg

(R)-N-Desacryloyl N-3-Chloropropionyl Ibrutinib

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS621346 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details