Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q8NNK3

Expression Region

1-143

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSSAKLMYGPTVFMAAMAVIYIFATMHVSDGGSVKGVEWVGSVALVLSAGLTLMLGVYL HFTEVRVDVLPEDWEEAEVADKAGTLGFFSPSSIWPAAMSGAVGFLAFGVVYFHYWMIAV GLMLLIFTITKLNLQYGVPKEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moxidectin-d3
TRC-M744802-1MG 1 mg

Moxidectin-d3

Sign In for Pricing
View Details
TNFRSF18 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]
TA806456BM 100 µL

TNFRSF18 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF740 conjugate, 0.1mg/mL
BNC741283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS506200 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
2,3,4-Trihydroxybenzylhydrazine-15N2 Oxalic Acid Salt (>90%)
TRC-T795032-1MG 1 mg

2,3,4-Trihydroxybenzylhydrazine-15N2 Oxalic Acid Salt (>90%)

Sign In for Pricing
View Details
MUSK Antibody
F50653-0.4ML 0.4 mL

MUSK Antibody

Sign In for Pricing
View Details