Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconobacter oxydans Protein CrcB homolog (crcB)

This Recombinant Gluconobacter oxydans Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q5HXN6

Expression Region

1-144

Origin

Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTTCLIVMVGGALGTLARYLVSVAAMPISRFIPWGTILPINALGSFVIGFFGTLTLAD GRYPVSENMRLFVMIGLCGGYTTFSSFSLQTLDLIRNDAWGRASVNVAASVILCIGAVAL GHITADGFNTGAIRIAQTATEEDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF488A conjugate, 0.1mg/mL
BNC882096-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF640R conjugate, 0.1mg/mL
BNC400639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details