Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECS05 (MJECS05)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECS05 (MJECS05) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Uncharacterized protein MJECS05

UniProt

Q60304

Expression Region

1-144

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESKEYRKLEYNYKAFLIFSKVAMLTFLTVGIGAIFTPQTYPIMPTIGFIVVAGIVSLIG MTIGALIIHQQYETLPANEKLEFKQKLLPEAYYICIELFGYGSLVLLYNTFTSNNPTLCV MSLLMAGLFILVVLVIWYFGYKSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Double Stranded DNA (dsDNA) (DSD/958), Biotin conjugate, 0.1mg/mL
BNCB0958-500 1x 500 µL

Double Stranded DNA (dsDNA) (DSD/958), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NMDAR2B Rabbit Polyclonal Antibody
HA500208 100 µL

NMDAR2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Jejunum
CR562866 5 µg

Tissue Total RNA, Jejunum

Sign In for Pricing
View Details
Polystyrene PHB (Wang resin)
H40013.5G 5 g

Polystyrene PHB (Wang resin)

Sign In for Pricing
View Details
P57 / KIP2 (KP10), CF405S conjugate, 0.1mg/mL
BNC040879-500 1x 500 µL

P57 / KIP2 (KP10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OA1 (GPR143) Rabbit Polyclonal Antibody
TA376726 100 µL

OA1 (GPR143) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details