Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECS05 (MJECS05)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECS05 (MJECS05) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Uncharacterized protein MJECS05

UniProt

Q60304

Expression Region

1-144

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESKEYRKLEYNYKAFLIFSKVAMLTFLTVGIGAIFTPQTYPIMPTIGFIVVAGIVSLIG MTIGALIIHQQYETLPANEKLEFKQKLLPEAYYICIELFGYGSLVLLYNTFTSNNPTLCV MSLLMAGLFILVVLVIWYFGYKSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MROH2A Antibody
KC-22329-01 50 μL

MROH2A Antibody

Sign In for Pricing
View Details
MROH2A Antibody
KC-22329-02 100 µL

MROH2A Antibody

Sign In for Pricing
View Details
MROH2A Antibody
KC-22329-03 1 mL

MROH2A Antibody

Sign In for Pricing
View Details
PLOD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D1]
TA803224BM 100 µL

PLOD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D1]

Sign In for Pricing
View Details
DAZL (NM_001351) Human Recombinant Protein
TP305328L 1 mg

DAZL (NM_001351) Human Recombinant Protein

Sign In for Pricing
View Details
2-Hexyl-1-decanol
TRC-H295710-50G 50 g

2-Hexyl-1-decanol

Sign In for Pricing
View Details