Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein

This Recombinant Probable disulfide formation protein spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q8GHM3

Expression Region

1-144

Origin

Pseudomonas resinovorans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hieff NGS™ S Taq DNA Polymerase for dA-Tailing
13486ES96 96 Tests

Hieff NGS™ S Taq DNA Polymerase for dA-Tailing

Sign In for Pricing
View Details
ENO2 Antibody
KC-6314-01 50 μL

ENO2 Antibody

Sign In for Pricing
View Details
ENO2 Antibody
KC-6314-02 100 µL

ENO2 Antibody

Sign In for Pricing
View Details
ENO2 Antibody
KC-6314-03 1 mL

ENO2 Antibody

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF594 conjugate, 0.1mg/mL
BNC941758-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spem2 Mouse Gene Knockout Kit (CRISPR)
KN500435 1 Kit

Spem2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details