Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein

This Recombinant Probable disulfide formation protein spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q8GHM3

Expression Region

1-144

Origin

Pseudomonas resinovorans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G5]
TA500725BM 100 µL

HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G5]

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF405S conjugate, 0.1mg/mL
BNC042222-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Indole
TRC-I577320-25G 25 g

Indole

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific
TAF-532-1 1 mL

Texas Red Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific

Sign In for Pricing
View Details
Rat Aspartate Aminotransferase 2 (AST2) ELISA Kit
RDR-AST2-Ra-01 96 Tests

Rat Aspartate Aminotransferase 2 (AST2) ELISA Kit

Sign In for Pricing
View Details
Rat Aspartate Aminotransferase 2 (AST2) ELISA Kit
RDR-AST2-Ra-02 48 Tests

Rat Aspartate Aminotransferase 2 (AST2) ELISA Kit

Sign In for Pricing
View Details