Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein

This Recombinant Probable disulfide formation protein spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q8GHM3

Expression Region

1-144

Origin

Pseudomonas resinovorans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Depp1 Mouse Gene Knockout Kit (CRISPR)
KN500498 1 Kit

Depp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cemip2 Mouse Gene Knockout Kit (CRISPR)
KN517788 1 Kit

Cemip2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGFR pTyr1172 Rabbit Polyclonal Antibody
AP20828PU-N 100 µg

EGFR pTyr1172 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HRP Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-
H-3101-1 1 mg

HRP Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (rKRT18/1190), CF647 conjugate, 0.1mg/mL
BNC473217-500 1x 500 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 680 Anti-human CD4 Antibody *SK3*
100420I0-AAT 100 Tests

IFluor® 680 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details