Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit B (mrpB)

This Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit B (mrpB) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B, Mrp complex subunit B, Multiple resistance and pH homeostasis protein B

UniProt

Q9RGZ4

Expression Region

1-144

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLKSNDVLLHTLTRVVTFIILAFSVYLFFAGHNNPGGGFIGGLMTASALLLMYLGFDM RSIKKAIPFDFTKMIAFGLLIAIFTGFGGLLVGDPYLTQYFEYYQIPILGETELTTALPF DLGIYLVVIGIALTIILTIAEDDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pBluescriptR-SEPTIN6 Plasmid
PVT21244 2 µg

pBluescriptR-SEPTIN6 Plasmid

Sign In for Pricing
View Details
Caprine Epinephrine (EPI) ELISA Kit-Competitive
EK2F108 96 Tests

Caprine Epinephrine (EPI) ELISA Kit-Competitive

Sign In for Pricing
View Details
Mouse Capn5 qPCR Primer Pair
QM10518S 200 Tests

Mouse Capn5 qPCR Primer Pair

Sign In for Pricing
View Details
IAN11 Antibody
orb791141 2 mg

IAN11 Antibody

Sign In for Pricing
View Details
MYL1 (Myosin Light Chain 1/3, Skeletal Muscle Isoform, MLC1/MLC3, MLC1F/MLC3F, Myosin Light Chain Alkali 1/2, Myosin Light Chain A1/A2) (HRP)
MBS6153657-01 0.1 mL

MYL1 (Myosin Light Chain 1/3, Skeletal Muscle Isoform, MLC1/MLC3, MLC1F/MLC3F, Myosin Light Chain Alkali 1/2, Myosin Light Chain A1/A2) (HRP)

Sign In for Pricing
View Details
MYL1 (Myosin Light Chain 1/3, Skeletal Muscle Isoform, MLC1/MLC3, MLC1F/MLC3F, Myosin Light Chain Alkali 1/2, Myosin Light Chain A1/A2) (HRP)
MBS6153657-02 5x 0.1 mL

MYL1 (Myosin Light Chain 1/3, Skeletal Muscle Isoform, MLC1/MLC3, MLC1F/MLC3F, Myosin Light Chain Alkali 1/2, Myosin Light Chain A1/A2) (HRP)

Sign In for Pricing
View Details