Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit B (mrpB)

This Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit B (mrpB) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B, Mrp complex subunit B, Multiple resistance and pH homeostasis protein B

UniProt

Q9RGZ4

Expression Region

1-144

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLKSNDVLLHTLTRVVTFIILAFSVYLFFAGHNNPGGGFIGGLMTASALLLMYLGFDM RSIKKAIPFDFTKMIAFGLLIAIFTGFGGLLVGDPYLTQYFEYYQIPILGETELTTALPF DLGIYLVVIGIALTIILTIAEDDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Immune Ribonucleic Acid/Immune Rna ELISA Kit
MBS035699 Inquire

Cavy Immune Ribonucleic Acid/Immune Rna ELISA Kit

Sign In for Pricing
View Details
VASP Rabbit Polyclonal Antibody (PE)
orb2616578 100 µg

VASP Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
G6PD (Glucose-6-phosphate 1-dehydrogenase) (MaxLight 750) discontinued
127073-ML750 100 µL

G6PD (Glucose-6-phosphate 1-dehydrogenase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TOR1AIP1 Recombinant Protein (Mouse)
RP180596 100 µg

TOR1AIP1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Junctional Adhesion MolecuLe 1 (F11R) (NM_016946) Human Recombinant Protein
TP720393L 500 µg

Junctional Adhesion MolecuLe 1 (F11R) (NM_016946) Human Recombinant Protein

Sign In for Pricing
View Details
Human Apolipoprotein A-4, APOA4 ELISA Kit
MBS1605912-01 48 Well

Human Apolipoprotein A-4, APOA4 ELISA Kit

Sign In for Pricing
View Details