Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit B (mrpB)

This Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit B (mrpB) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B, Mrp complex subunit B, Multiple resistance and pH homeostasis protein B

UniProt

Q9RGZ4

Expression Region

1-144

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLKSNDVLLHTLTRVVTFIILAFSVYLFFAGHNNPGGGFIGGLMTASALLLMYLGFDM RSIKKAIPFDFTKMIAFGLLIAIFTGFGGLLVGDPYLTQYFEYYQIPILGETELTTALPF DLGIYLVVIGIALTIILTIAEDDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13C2/OR13C9 Antibody
A23725-50UG 50 µg

OR13C2/OR13C9 Antibody

Sign In for Pricing
View Details
PDPN Peptide
orb2016048 100 µg

PDPN Peptide

Sign In for Pricing
View Details
Keratin, Type I Cytoskeletal 18 (KRT18) Antibody
abx405418-01 100 µL

Keratin, Type I Cytoskeletal 18 (KRT18) Antibody

Sign In for Pricing
View Details
Keratin, Type I Cytoskeletal 18 (KRT18) Antibody
abx405418-02 200 µL

Keratin, Type I Cytoskeletal 18 (KRT18) Antibody

Sign In for Pricing
View Details
Keratin, Type I Cytoskeletal 18 (KRT18) Antibody
abx405418-03 1 mL

Keratin, Type I Cytoskeletal 18 (KRT18) Antibody

Sign In for Pricing
View Details
Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) ELISA Kit
RD-LRG1-Mu-96Tests 96 Tests

Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) ELISA Kit

Sign In for Pricing
View Details