Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yiaA (yiaA)

This Recombinant Inner membrane protein yiaA (yiaA) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Inner membrane protein yiaA

UniProt

P0ADJ9

Expression Region

1-145

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK TVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVA VQKNIRDAGINPPKETQVTQEEYSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl7 Mouse shRNA Lentiviral Particle (Locus ID 52323)
TL502885V 500 µL Each

Klhl7 Mouse shRNA Lentiviral Particle (Locus ID 52323)

Sign In for Pricing
View Details
Benzbromarone 200mg
A16201-200 200 mg

Benzbromarone 200mg

Sign In for Pricing
View Details
CNTROB Antibody Blocking Peptide
orb1504336 500 µg

CNTROB Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human ENPP1 Protein, N-His
AP93414 50 µg

Recombinant Human ENPP1 Protein, N-His

Sign In for Pricing
View Details
C18orf24 Antibody
MBS8576305-01 0.2 mL

C18orf24 Antibody

Sign In for Pricing
View Details
C18orf24 Antibody
MBS8576305-02 0.1 mL (AF405L)

C18orf24 Antibody

Sign In for Pricing
View Details