Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yiaA (yiaA)

This Recombinant Inner membrane protein yiaA (yiaA) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Inner membrane protein yiaA

UniProt

P0ADJ9

Expression Region

1-145

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK TVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVA VQKNIRDAGINPPKETQVTQEEYSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYLK3 (NM_182493) Human Tagged Lenti ORF Clone
RC222246L2 10 µg

MYLK3 (NM_182493) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TSC1, Phosphorylated (S321) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)
MBS6359012-01 0.2 mL

TSC1, Phosphorylated (S321) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)

Sign In for Pricing
View Details
TSC1, Phosphorylated (S321) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)
MBS6359012-02 5x 0.2 mL

TSC1, Phosphorylated (S321) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)

Sign In for Pricing
View Details
Protein C tag Polyclonal Antibody, APC Conjugated
bs-25424R-APC 100 µL

Protein C tag Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Human HIPK3 (N-His tag)
MBS4160168-01 0.01 mg

Recombinant Human HIPK3 (N-His tag)

Sign In for Pricing
View Details
Recombinant Human HIPK3 (N-His tag)
MBS4160168-02 5x 0.01 mg

Recombinant Human HIPK3 (N-His tag)

Sign In for Pricing
View Details