Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yiaA (yiaA)

This Recombinant Inner membrane protein yiaA (yiaA) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Inner membrane protein yiaA

UniProt

P0ADJ9

Expression Region

1-145

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK TVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVA VQKNIRDAGINPPKETQVTQEEYSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey monocyte chemotactic protein 2 (MCP-2; CCL8) ELISA Kit
YP-W70999-01 48 Tests

Monkey monocyte chemotactic protein 2 (MCP-2; CCL8) ELISA Kit

Sign In for Pricing
View Details
Monkey monocyte chemotactic protein 2 (MCP-2; CCL8) ELISA Kit
YP-W70999-02 96 Tests

Monkey monocyte chemotactic protein 2 (MCP-2; CCL8) ELISA Kit

Sign In for Pricing
View Details
ENTPD4 polyclonal antibody
BS76801-01 50 µL

ENTPD4 polyclonal antibody

Sign In for Pricing
View Details
ENTPD4 polyclonal antibody
BS76801-02 100 µL

ENTPD4 polyclonal antibody

Sign In for Pricing
View Details
DPP8 293 Cell Lysate
402883 0.1 mg

DPP8 293 Cell Lysate

Sign In for Pricing
View Details
Rat Pentraxin3/TSG14 ELISA Kit
MBS724459-01 48 Strip Well (Competitive)

Rat Pentraxin3/TSG14 ELISA Kit

Sign In for Pricing
View Details