Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelotomaculum thermopropionicum UPF0756 membrane protein PTH_1817 (PTH_1817)

This Recombinant Pelotomaculum thermopropionicum UPF0756 membrane protein PTH_1817 (PTH_1817) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

UPF0756 membrane protein PTH_1817

UniProt

A5D176

Expression Region

1-146

Origin

Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVVLLLIGMAAHSSLIVIAACILLILKLTNVNFIFSLLERRGLEMGLTFLLLSILVPLA SGKASWQEIISSLASFSGLLAVAGGALATSLNTRGLNLLKADPEIVFGLLLGSILGIVFL HGIPVGPLMAAGITALLMQLARIFKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF405S conjugate, 0.1mg/mL
BNC042172-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF488A conjugate, 0.1mg/mL
BNC882383-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details