Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis Spermidine export protein MdtJ (mdtJ)

This Recombinant Yersinia pestis Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

A4TJJ0

Expression Region

1-147

Origin

Yersinia pestis (strain Pestoides F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNCHRGNRPP SVQELKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-500 1x 500 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details