Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 Spermidine export protein MdtJ (mdtJ)

This Recombinant Yersinia pseudotuberculosis serotype O:3 Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

B1JLJ8

Expression Region

1-147

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-100 1x 100 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (PRLR/742), CF568 conjugate, 0.1mg/mL
BNC680742-100 1x 100 µL

Prolactin Receptor (PRLR/742), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), CF594 conjugate, 0.1mg/mL
BNC942147-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF405S conjugate, 0.1mg/mL
BNC041712-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details