Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. Protein CrcB homolog 2 (crcB2)

This Recombinant Frankia sp. Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2JAK0

Expression Region

1-147

Origin

Frankia sp. (strain CcI3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRRQLRHAPVAVLLLAVISAGGAVGACARYGASLVWPTMPGTFPWTTWAVNTAGCAAIG VLMVLITDVRTVHPLVRPFLGTGVLGGFTTFSTYALDAQRLVDGGRTGLALAYLVLSVLA ALGAVWAAAAAMRWFVARTRRVAGRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF647 conjugate, 0.1mg/mL
BNC472993-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL
BNC401926-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details