Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q66AS9

Expression Region

1-147

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLURP2 protein, Human, Recombinant (His)
E51P90876 20 µg

SLURP2 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Human MTMR14 Pre-designed siRNA Set B
SI009996B 1 Each

Human MTMR14 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ATP Synthase (Mitochondrial Complex V) Microplate Assay Kit
RDSM124 100 Assays

ATP Synthase (Mitochondrial Complex V) Microplate Assay Kit

Sign In for Pricing
View Details
Mouse Monoclonal TGF-beta 2 Antibody (MM0640-6M28) [HRP]
NBP2-32727H 0.1 mL

Mouse Monoclonal TGF-beta 2 Antibody (MM0640-6M28) [HRP]

Sign In for Pricing
View Details
Mouse Polyclonal DIP2C Antibody
H00022982-B01P-50ug 50 µg

Mouse Polyclonal DIP2C Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to HAUS Augmin Like Complex Subunit 7 (HAUS7)
MBS2083943-01 0.1 mL

HRP-Linked Polyclonal Antibody to HAUS Augmin Like Complex Subunit 7 (HAUS7)

Sign In for Pricing
View Details