Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q66AS9

Expression Region

1-147

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC2 Rabbit pAb
A19523 50 µL

BNC2 Rabbit pAb

Sign In for Pricing
View Details
CORO2A Polyclonal Antibody
E914469 100 µL

CORO2A Polyclonal Antibody

Sign In for Pricing
View Details
Insig1, NT (Insulin-induced gene 1 protein, INSIG-1, CL6, CL-6, MGC1405) (MaxLight 650) discontinued
I7655-85N-ML650 100 µL

Insig1, NT (Insulin-induced gene 1 protein, INSIG-1, CL6, CL-6, MGC1405) (MaxLight 650) discontinued

Sign In for Pricing
View Details
EI2BB discontinued
535874-01 30ul

EI2BB discontinued

Sign In for Pricing
View Details
EI2BB discontinued
535874-02 100 µL

EI2BB discontinued

Sign In for Pricing
View Details
Rabbit Anti-SPA-1 antibody
SL1602R-01 50 µL

Rabbit Anti-SPA-1 antibody

Sign In for Pricing
View Details