Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q66AS9

Expression Region

1-147

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHF Rabbit pAb, AE conjugated
orb2878443 100 µL

EHF Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
SLC35E3-set siRNA/shRNA/RNAi Lentivector (Human)
44145091 4x 500 ng

SLC35E3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ADD1 (Alpha-adducin, Erythrocyte Adducin Subunit alpha, ADDA) APC
MBS6135195-01 0.1 mL

ADD1 (Alpha-adducin, Erythrocyte Adducin Subunit alpha, ADDA) APC

Sign In for Pricing
View Details
ADD1 (Alpha-adducin, Erythrocyte Adducin Subunit alpha, ADDA) APC
MBS6135195-02 5x 0.1 mL

ADD1 (Alpha-adducin, Erythrocyte Adducin Subunit alpha, ADDA) APC

Sign In for Pricing
View Details
ACCN5 (ASIC5, ACCN5, HINAC, Acid-sensing Ion Channel 5, Amiloride-sensitive Cation Channel 5, Human Intestine Na (+) Channel) (MaxLight 750) discontinued
137515-ML750 100 µL

ACCN5 (ASIC5, ACCN5, HINAC, Acid-sensing Ion Channel 5, Amiloride-sensitive Cation Channel 5, Human Intestine Na (+) Channel) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PLX51107 5mg
A18345-5 5 mg

PLX51107 5mg

Sign In for Pricing
View Details