Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q7CIC6

Expression Region

1-147

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNCHRGNRPP SVQELKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S100A8/A9 Antibody (48M7C7) [Alexa Fluor 405]
NBP2-25269AF405 0.1 mL

Mouse Monoclonal S100A8/A9 Antibody (48M7C7) [Alexa Fluor 405]

Sign In for Pricing
View Details
Human Ribonuclease L (RNASEL) ELISA Kit
orb2811823-01 48 Tests

Human Ribonuclease L (RNASEL) ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease L (RNASEL) ELISA Kit
orb2811823-02 96 Tests

Human Ribonuclease L (RNASEL) ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease L (RNASEL) ELISA Kit
orb2811823-03 5 x 96 T

Human Ribonuclease L (RNASEL) ELISA Kit

Sign In for Pricing
View Details
Anti-PPM1B Antibody Picoband® FITC Conjugated
A05731-1-FITC 100 µg/Vial

Anti-PPM1B Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group M subtype B Gag-Pol polyprotein (gag-pol), partial
MBS1375724 Inquire

Recombinant Human immunodeficiency virus type 1 group M subtype B Gag-Pol polyprotein (gag-pol), partial

Sign In for Pricing
View Details