Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q7CIC6

Expression Region

1-147

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNCHRGNRPP SVQELKTQTTGHHKGVAVESGEHHAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CXCL12/SDF-1 alpha Protein
NBP2-35155-1mg 1 mg

Recombinant Mouse CXCL12/SDF-1 alpha Protein

Sign In for Pricing
View Details
Phospho-RAD51 (Thr309) Rabbit Polyclonal Antibody (BF405)
orb1582739 100 µL

Phospho-RAD51 (Thr309) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
RPGRIP1 (C-9) Alexa Fluor® 594
sc-390341 AF594 200 µg/mL

RPGRIP1 (C-9) Alexa Fluor® 594

Sign In for Pricing
View Details
GSTO2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E7]
TA504075AM 100 µL

GSTO2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E7]

Sign In for Pricing
View Details
Anti-MICALL2 antibody
PAab05179 100 µg

Anti-MICALL2 antibody

Sign In for Pricing
View Details
Fgf10 (NM_008002) Mouse Untagged Clone
MC207273 10 µg

Fgf10 (NM_008002) Mouse Untagged Clone

Sign In for Pricing
View Details