Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica subsp. palearctica serotype O:3 L-alanine exporter AlaE (alaE)

This Recombinant Yersinia enterocolitica subsp. palearctica serotype O:3 L-alanine exporter AlaE (alaE) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

L-alanine exporter AlaE

UniProt

E7B4A5

Expression Region

1-148

Origin

Yersinia enterocolitica subsp. palearctica serotype O:3 (strain DSM 13030 / CIP 106945 / Y11)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFSTRSRLRSAAADTFALVVYCFVIGMIIEIVISGMTFQQSLSSRLVSIPVNILIAWP YGLYRDAFIRFARRHAGEHMWARNLADLLAYVSFQSPVYALILWSVGADLEQITTAVASN ALVSMAMGVAYGYFLEYCRKLFRVAGYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF647 conjugate, 0.1mg/mL
BNC471010-500 1x 500 µL

Cytochrome C (CYCS/1010), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL
BNC680201-500 1x 500 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF640R conjugate, 0.1mg/mL
BNC402488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details