Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubrobacter xylanophilus Protein CrcB homolog 2 (crcB2)

This Recombinant Rubrobacter xylanophilus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q1AYN1

Expression Region

1-148

Origin

Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHEAPRGFLEGEALRPRPFRAGLGHLGWIFAGGALGAAARLAVEGAARRLAPAAYEAFPW GTLAANAAGSFLIAIFGTLIFERFVGERARAFWVLGFLGSLTTFSSYALHTLRGWEASPL LGGLYGGGSLLLGLLAALAGLRLTRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Roflumilast Impurity 59
RM-R458085-01 10 mg

Roflumilast Impurity 59

Sign In for Pricing
View Details
Roflumilast Impurity 59
RM-R458085-02 100 mg

Roflumilast Impurity 59

Sign In for Pricing
View Details
Roflumilast Impurity 59
RM-R458085-03 25 mg

Roflumilast Impurity 59

Sign In for Pricing
View Details
Roflumilast Impurity 59
RM-R458085-04 50 mg

Roflumilast Impurity 59

Sign In for Pricing
View Details
OR6U2P AAV Vector (Human) (CMV)
35531101 1 µg

OR6U2P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
BMP6 Rabbit pAb, Pacific Blue conjugated
orb2842013 100 µL

BMP6 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details