Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubrobacter xylanophilus Protein CrcB homolog 2 (crcB2)

This Recombinant Rubrobacter xylanophilus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q1AYN1

Expression Region

1-148

Origin

Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHEAPRGFLEGEALRPRPFRAGLGHLGWIFAGGALGAAARLAVEGAARRLAPAAYEAFPW GTLAANAAGSFLIAIFGTLIFERFVGERARAFWVLGFLGSLTTFSSYALHTLRGWEASPL LGGLYGGGSLLLGLLAALAGLRLTRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Leukotriene D4 (LT-D4) ELISA Kit
MBS2803614-01 48 Tests

Mouse Leukotriene D4 (LT-D4) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukotriene D4 (LT-D4) ELISA Kit
MBS2803614-02 96 Tests

Mouse Leukotriene D4 (LT-D4) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukotriene D4 (LT-D4) ELISA Kit
MBS2803614-03 5x 96 Tests

Mouse Leukotriene D4 (LT-D4) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukotriene D4 (LT-D4) ELISA Kit
MBS2803614-04 10x 96 Tests

Mouse Leukotriene D4 (LT-D4) ELISA Kit

Sign In for Pricing
View Details
CALM3 Rabbit Polyclonal Antibody
orb1174479 100 µg

CALM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rab Antibody
OAAJ11896-100UL 100 µL

Rab Antibody

Sign In for Pricing
View Details