Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived disulfide bond formation protein B (bdbB)

This Recombinant Bacillus subtilis SPBc2 prophage-derived disulfide bond formation protein B (bdbB) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived disulfide bond formation protein B, Disulfide oxidoreductase B, Thiol-disulfide oxidoreductase B

UniProt

P68571

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKK DLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSS VCFALIFGIGLKLIIKSKKLKQNQHVYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NYAP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV772118 1.0 µg DNA

NYAP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human MOSPD2 Protein, N-His
EHK11801 100 μg

Recombinant Human MOSPD2 Protein, N-His

Sign In for Pricing
View Details
Rad9 3'UTR Luciferase Stable Cell Line
TU117482 1.0 mL

Rad9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
4,4'-Oxydianiline-d12
HY-W014896S 1 mg

4,4'-Oxydianiline-d12

Sign In for Pricing
View Details
Antiarol
orb1304824 100 mg

Antiarol

Sign In for Pricing
View Details
β-defensin 46 shRNA Plasmid (m)
sc-143756-SH 20 µg

β-defensin 46 shRNA Plasmid (m)

Sign In for Pricing
View Details