Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived disulfide bond formation protein B (bdbB)

This Recombinant Bacillus subtilis SPBc2 prophage-derived disulfide bond formation protein B (bdbB) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived disulfide bond formation protein B, Disulfide oxidoreductase B, Thiol-disulfide oxidoreductase B

UniProt

P68571

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKK DLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSS VCFALIFGIGLKLIIKSKKLKQNQHVYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UIMC1 Rabbit pAb
E45R21068N 50 ul

UIMC1 Rabbit pAb

Sign In for Pricing
View Details
RNF128, ID (RNF128, GRAIL, E3 ubiquitin-protein ligase RNF128, Gene related to anergy in lymphocytes protein, RING finger protein 128) (MaxLight 405)
MBS6342560-01 0.1 mL

RNF128, ID (RNF128, GRAIL, E3 ubiquitin-protein ligase RNF128, Gene related to anergy in lymphocytes protein, RING finger protein 128) (MaxLight 405)

Sign In for Pricing
View Details
RNF128, ID (RNF128, GRAIL, E3 ubiquitin-protein ligase RNF128, Gene related to anergy in lymphocytes protein, RING finger protein 128) (MaxLight 405)
MBS6342560-02 5x 0.1 mL

RNF128, ID (RNF128, GRAIL, E3 ubiquitin-protein ligase RNF128, Gene related to anergy in lymphocytes protein, RING finger protein 128) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0320 protein YER188C-A (YER188C-A)
MBS1233820-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae UPF0320 protein YER188C-A (YER188C-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0320 protein YER188C-A (YER188C-A)
MBS1233820-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae UPF0320 protein YER188C-A (YER188C-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0320 protein YER188C-A (YER188C-A)
MBS1233820-03 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae UPF0320 protein YER188C-A (YER188C-A)

Sign In for Pricing
View Details