Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived disulfide bond formation protein B (bdbB)

This Recombinant Bacillus subtilis SPBc2 prophage-derived disulfide bond formation protein B (bdbB) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived disulfide bond formation protein B, Disulfide oxidoreductase B, Thiol-disulfide oxidoreductase B

UniProt

P68571

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKK DLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSS VCFALIFGIGLKLIIKSKKLKQNQHVYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal Anti-Myosin light chains Clone A12
TA353362L 500 µg

Mouse monoclonal Anti-Myosin light chains Clone A12

Sign In for Pricing
View Details
Mouse EGFR/ERBB1 Antibody , PE
E55A11074 50 Tests

Mouse EGFR/ERBB1 Antibody , PE

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Protein TolB (tolB)
MBS1305210-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Protein TolB (tolB)
MBS1305210-02 0.02 mg (Yeast)

Recombinant Xylella fastidiosa Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Protein TolB (tolB)
MBS1305210-03 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Protein TolB (tolB)
MBS1305210-04 0.1 mg (Yeast)

Recombinant Xylella fastidiosa Protein TolB (tolB)

Sign In for Pricing
View Details