Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydeH (ydeH)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydeH (ydeH) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydeH

UniProt

P96665

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHIKWLSDLKKAGLLALGKGVITLLKRFSLVIVTLMMSIVVVLAAAKESPGDHVISFDE PIILMISIGIVVFLLIPPLVMSFFGNLVVRIISGVYQCFIVFTFLGLIPIGFLIPNGFLT ILVSIAGTLVSIASVAVTLCIGKNKKDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXFP2 Polyclonal Antibody
E-AB-66267-01 60 µL

RXFP2 Polyclonal Antibody

Sign In for Pricing
View Details
RXFP2 Polyclonal Antibody
E-AB-66267-02 120 µL

RXFP2 Polyclonal Antibody

Sign In for Pricing
View Details
RXFP2 Polyclonal Antibody
E-AB-66267-03 200 µL

RXFP2 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS716636 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
N-tert-Butyl-4-aminobenzenesulfonamide
TRC-B690795-50G 50 g

N-tert-Butyl-4-aminobenzenesulfonamide

Sign In for Pricing
View Details
Tnrc6a Mouse Gene Knockout Kit (CRISPR)
KN518032 1 Kit

Tnrc6a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details