Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydeH (ydeH)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydeH (ydeH) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydeH

UniProt

P96665

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHIKWLSDLKKAGLLALGKGVITLLKRFSLVIVTLMMSIVVVLAAAKESPGDHVISFDE PIILMISIGIVVFLLIPPLVMSFFGNLVVRIISGVYQCFIVFTFLGLIPIGFLIPNGFLT ILVSIAGTLVSIASVAVTLCIGKNKKDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 4933407K13Rik activation kit by CRISPRa
GA209865 1 Kit

Mouse 4933407K13Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: R07-1G1]
TA384751 100 µL

Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: R07-1G1]

Sign In for Pricing
View Details
Furfuryl-d5 Alcohol
TRC-F864221-2MG 2 mg

Furfuryl-d5 Alcohol

Sign In for Pricing
View Details
LCK Human Gene Knockout Kit (CRISPR)
KN219375RB 1 Kit

LCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IDH3A Human Gene Knockout Kit (CRISPR)
KN200313LP 1 Kit

IDH3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PADI4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E7]
TA504814AM 100 µL

PADI4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E7]

Sign In for Pricing
View Details